Structure of PDB 5jk0 Chain B Binding Site BS02

Receptor Information
>5jk0 Chain B (length=345) Species: 85962 (Helicobacter pylori 26695) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKHPLEELKDPTENLLLWIGRFLRYKCTSLSNSQVKDQNKVFECLNELNQ
ACSSSQLEKVCKKARNAGLLGINTYALPLLKFHEYFSKARLITFNSLKNI
DEVMLAEFLSVYTGGLSLATKKNYRIALLGLFSYIDKQNQDENEKSYIYN
ITLKKLPTHLNNEELEKFLESIDKIEMSAKVRARNRLLIKIIVFTGMRSN
EALQLKIKDFTLENGCYTILIKGKGDKYRAVMLKAFHIESLLKEWLIERE
LYPVKNDLLFCNQKGSALTQAYLYKQVERIINFAGLRREKNGAHMLRHSF
ATLLYQKRHDLILVQEALGHASLNTSRIYTHFDKQRLEEAASIWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jk0 Structural snapshots of Xer recombination reveal activation by synaptic complex remodeling and DNA bending.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		K26 L30 S31 L70 G71 N73 T74 Y75 K126 R129 K158 S214 N215 Q285 Y289 G307 H309
Binding residue
(residue number reindexed from 1)		K26 L30 S31 L70 G71 N73 T74 Y75 K122 R125 K154 S199 N200 Q270 Y274 G292 H294
Binding affinityPDBbind-CN: Kd=150nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0009037 tyrosine-based site-specific recombinase activity
Biological Process
GO:0006310 DNA recombination
GO:0007059 chromosome segregation
GO:0015074 DNA integration
GO:0051301 cell division
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jk0, PDBe:5jk0, PDBj:5jk0
PDBsum5jk0
PubMed28009253
UniProtO25386|XERH_HELPY Tyrosine recombinase XerH (Gene Name=xerH)

[Back to BioLiP]