Structure of PDB 5j3e Chain B Binding Site BS02

Receptor Information

>5j3e Chain B (length=171) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLR
AMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKE
DNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRL
SIQPLTQEEFDFVLSLEEKEP

Ligand information

>5j3e Chain D (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccaacgttggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5j3e Crystal Structure of Human THYN1 protein in complex with 5-methylcytosine containing DNA
Resolution	2.6 Å
Binding residue (original residue number in PDB)	Q201 R202
Binding residue (residue number reindexed from 1)	Q148 R149

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5j3e, PDBe:5j3e, PDBj:5j3e
PDBsum	5j3e
PubMed
UniProt	Q9P016\|THYN1_HUMAN Thymocyte nuclear protein 1 (Gene Name=THYN1)

[Back to BioLiP]