Structure of PDB 5j2y Chain B Binding Site BS02

Receptor Information

>5j2y Chain B (length=68) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PQNMAFRAKATRTARRESQETFWSRFGISQSCGSRFENGENLPFPIYLLL
HFYIEGQITDRQLADLRG

Ligand information

>5j2y Chain f (length=25) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaattatgaaatttgcataaattc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5j2y Molecular insight into the regulatory mechanism of the quorum-sensing repressor RsaL in Pseudomonas aeruginosa
Resolution	2.4 Å
Binding residue (original residue number in PDB)	S37 S39 R43
Binding residue (residue number reindexed from 1)	S29 S31 R35

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:5j2y, PDBe:5j2y, PDBj:5j2y
PDBsum	5j2y
PubMed	27924027
UniProt	Q9X7H4

[Back to BioLiP]