Structure of PDB 5iwi Chain B Binding Site BS02

Receptor Information
>5iwi Chain B (length=192) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNV
EKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGA
HIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNP
EHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5iwi Novel tricyclics (e.g., GSK945237) as potent inhibitors of bacterial type IIA topoisomerases.
Resolution1.98 Å
Binding residue
(original residue number in PDB)		K460 L462 N463 K466 R471 H515 V626 R629
Binding residue
(residue number reindexed from 1)		K46 L48 N49 K52 R57 H101 V178 R181
Enzymatic activity
Enzyme Commision number 5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524 ATP binding
Biological Process
GO:0006265 DNA topological change

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5iwi, PDBe:5iwi, PDBj:5iwi
PDBsum5iwi
PubMed27055939
UniProtP66937|GYRB_STAAN DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]