Structure of PDB 5hyt Chain B Binding Site BS02

Receptor Information
>5hyt Chain B (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNS
DGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIG
STTSRCEVQDRGVGWSHPLPQCEI
Ligand information
>5hyt Chain C (length=28) Species: 1314 (Streptococcus pyogenes) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ISQESKLINTLTDENEKLREELQQYYAL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hyt Conserved patterns hidden within group A Streptococcus M protein hypervariability recognize human C4b-binding protein.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		R64 I78
Binding residue
(residue number reindexed from 1)		R64 I78
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5hyt, PDBe:5hyt, PDBj:5hyt
PDBsum5hyt
PubMed27595425
UniProtP04003|C4BPA_HUMAN C4b-binding protein alpha chain (Gene Name=C4BPA)

[Back to BioLiP]