Structure of PDB 5gnj Chain B Binding Site BS02

Receptor Information

>5gnj Chain B (length=77) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELK
SKVVKTESEKLQIKNQLEEVKLELAGR

Ligand information

>5gnj Chain D (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggtcacgtgttcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5gnj Crystal Structure of Tetrameric Arabidopsis MYC2 Reveals the Mechanism of Enhanced Interaction with DNA.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	H453 E457 R458 R461 K483
Binding residue (residue number reindexed from 1)	H5 E9 R10 R13 K35
Binding affinity	PDBbind-CN: Kd=0.8uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0046983	protein dimerization activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5gnj, PDBe:5gnj, PDBj:5gnj
PDBsum	5gnj
PubMed	28514654
UniProt	Q39204\|MYC2_ARATH Transcription factor MYC2 (Gene Name=MYC2)

[Back to BioLiP]