Structure of PDB 5gke Chain B Binding Site BS02

Receptor Information

>5gke Chain B (length=239) Species: 69014 (Thermococcus kodakarensis KOD1)

SKDKVTVITSPSTEELVSLVNSALLEEAMLTIFARCKVHYDGRAKSELGS
GDRVIIVKPDGSFLIHQSKKREPVNWQPPGSRVRLELRENPVLVSIRRKP
RETLEVELEEVYMVSVFRAEDYEELALTGSEAEMAELIFENPEVIEPGFK
PLFREKAIGTGIVAVLGRDSDGNIVVLELKRRRAELHAVRQLKSYVEILR
EEYGDKVRGILVAPSLTSGAKRLLEKEGLEFRKLEPPKR

Ligand information

>5gke Chain D (length=15)

ggacgacgtgtagcg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5gke Structure of the EndoMS-DNA Complex as Mismatch Restriction Endonuclease
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): K71 R72 E73 K100 S131 E132 G162 I163 K181 R182 R183 Q192 Y196
• Binding residue (residue number reindexed from 1): K70 R71 E72 K99 S130 E131 G161 I162 K180 R181 R182 Q191 Y195
• Binding affinity: PDBbind-CN: Kd=3.4nM

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0000014 single-stranded DNA endodeoxyribonuclease activity
• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0004519 endonuclease activity

Biological Process

• GO:0006259 DNA metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5gke, PDBe:5gke, PDBj:5gke
• PDBsum: 5gke
• PubMed: 27773688
• UniProt: Q5JER9|NUCS_THEKO Endonuclease NucS (Gene Name=nucS)