Structure of PDB 5g32 Chain B Binding Site BS02

Receptor Information
>5g32 Chain B (length=115) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APKCIECHINIEMDPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYF
LTDPELNDEDLFHRLEKPNPHSGTFARMQLFVRCEVEAFAFKKWGGEEGL
DEEWQRREEGKAHRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5g32 Structural Basis for Bulky Adduct DNA Lesion Recognition by the Nucleotide Excision Repair Protein Rad14.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		T228 K229 T230 E231 E234 H258 A263 R264 M265 Q266
Binding residue
(residue number reindexed from 1)		T41 K42 T43 E44 E47 H71 A76 R77 M78 Q79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003684 damaged DNA binding
Biological Process
GO:0006289 nucleotide-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5g32, PDBe:5g32, PDBj:5g32
PDBsum5g32
PubMed27223336
UniProtP28519|RAD14_YEAST DNA repair protein RAD14 (Gene Name=RAD14)

[Back to BioLiP]