Structure of PDB 5fvl Chain B Binding Site BS02

Receptor Information
>5fvl Chain B (length=78) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSK
DLIRAKFTEYLNRAEQLKKHLESEEANA
Ligand information
>5fvl Chain D (length=26) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPEKMNNAKVANMPSTEGLPSLPQGE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fvl Structural Fine-Tuning of Mit Interacting Motif 2 (Mim2) and Allosteric Regulation of Escrt-III by Vps4 in Yeast.
Resolution1.973 Å
Binding residue
(original residue number in PDB)		D19 T22 A23 Q25
Binding residue
(residue number reindexed from 1)		D16 T19 A20 Q22
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5fvl, PDBe:5fvl, PDBj:5fvl
PDBsum5fvl
PubMed27075672
UniProtP52917|VPS4_YEAST Vacuolar protein sorting-associated protein 4 (Gene Name=VPS4)

[Back to BioLiP]