Structure of PDB 5fdk Chain B Binding Site BS02

Receptor Information
>5fdk Chain B (length=166) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLEDDLNETNKYYLTNQIAVIHKKPTPVQIVNVHYPKRSAAVIKEAYFKQ
SSTTNYNGIYKGRYIDFEAKETKNKTSFPLQNFHDHQIEHMKQVKAQDGI
CFVIISAFDQVYFLEADKLFYFWDRKEKNGRKSIRKDELEETAYPISLGY
APRIDYISIIEQLYFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fdk Structural insights into dynamics of RecU-HJ complex formation elucidates key role of NTR and stalk region toward formation of reactive state.
Resolution3.208 Å
Binding residue
(original residue number in PDB)		F81 Q83
Binding residue
(residue number reindexed from 1)		F48 Q50
Enzymatic activity
Enzyme Commision number 3.1.21.10: crossover junction endodeoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0007059 chromosome segregation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fdk, PDBe:5fdk, PDBj:5fdk
PDBsum5fdk
PubMed27903910
UniProtP39792|RECU_BACSU Holliday junction resolvase RecU (Gene Name=recU)

[Back to BioLiP]