Structure of PDB 5f8a Chain B Binding Site BS02

Receptor Information
>5f8a Chain B (length=244) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPI
INKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENE
KIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTY
NINELNEIPKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVE
GKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIYRGRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5f8a Metal Ion Binding at the Catalytic Site Induces Widely Distributed Changes in a Sequence Specific Protein-DNA Complex.
Resolution1.76 Å
Binding residue
(original residue number in PDB)		N70 K92 T93 T94 Y95 T106 T111 S112 K119 N120 S183 T186 N188
Binding residue
(residue number reindexed from 1)		N69 K91 T92 T93 Y94 T105 T110 S111 K118 N119 S182 T185 N187
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5f8a, PDBe:5f8a, PDBj:5f8a
PDBsum5f8a
PubMed27786446
UniProtP04390|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]