Structure of PDB 5epl Chain B Binding Site BS02

Receptor Information
>5epl Chain B (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLI
AFQNRERQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5epl A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
Resolution1.81 Å
Binding residue
(original residue number in PDB)		H9 V10 F11 A12 V13 W32 W35 E43 N47 L49 D50 R52 L53
Binding residue
(residue number reindexed from 1)		H4 V5 F6 A7 V8 W27 W30 E38 N42 L44 D45 R47 L48
Enzymatic activity
Enzyme Commision number 2.3.2.-
Gene Ontology
Biological Process
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5epl, PDBe:5epl, PDBj:5epl
PDBsum5epl
PubMed26807715
UniProtO00257|CBX4_HUMAN E3 SUMO-protein ligase CBX4 (Gene Name=CBX4)

[Back to BioLiP]