Structure of PDB 5eea Chain B Binding Site BS02

Receptor Information

>5eea Chain B (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLAK

Ligand information

>5eea Chain E (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggacccaataaaacacaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5eea Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
Resolution	2.195 Å
Binding residue (original residue number in PDB)	R220 P222 F240 K243 R246 Q265 R268 K272
Binding residue (residue number reindexed from 1)	R4 P6 F24 K27 R30 Q49 R52 K56
Binding affinity	PDBbind-CN: Kd=41nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5eea, PDBe:5eea, PDBj:5eea
PDBsum	5eea
PubMed	29638214
UniProt	Q92826\|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]