Structure of PDB 5df5 Chain B Binding Site BS02

Receptor Information

>5df5 Chain B (length=104) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GDVEKGKKIFVQKCAQCHTVEKGGKHKEGPNLHGLFGRKTGQAAGFSYTD
ANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK
ATNE

Ligand information

InChI=1S/6CN.Fe/c6*1-2;

HCMVSLMENOCDCK-UHFFFAOYSA-N

SMILES

Software	SMILES
OpenEye OEToolkits 1.5.0	C(#N)[Fe](C#N)(C#N)(C#N)(C#N)C#N
ACDLabs 10.04 CACTVS 3.341	N#C[Fe](C#N)(C#N)(C#N)(C#N)C#N

Formula

C6 Fe N6

Name

HEXACYANOFERRATE(3-);
FERRI(III)HEXACYANIDE

PDB chain

5df5 Chain B Residue 202 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5df5 Phosphomimetic substitution of cytochrome C tyrosine 48 decreases respiration and binding to cardiolipin and abolishes ability to trigger downstream caspase activation.
Resolution	1.301 Å
Binding residue (original residue number in PDB)	K87 K88 G89
Binding residue (residue number reindexed from 1)	K87 K88 G89
Annotation score	1

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0019899	enzyme binding
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0002931	response to ischemia
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen
GO:0006915	apoptotic process
GO:0006979	response to oxidative stress
GO:0009629	response to gravity
GO:0010730	negative regulation of hydrogen peroxide biosynthetic process
GO:0034349	glial cell apoptotic process
GO:0034465	response to carbon monoxide
GO:0042743	hydrogen peroxide metabolic process
GO:0046688	response to copper ion
GO:1901857	positive regulation of cellular respiration

	Cellular Component
GO:0005739	mitochondrion
GO:0005758	mitochondrial intermembrane space
GO:0005829	cytosol
GO:0043293	apoptosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5df5, PDBe:5df5, PDBj:5df5
PDBsum	5df5
PubMed
UniProt	P62898\|CYC_RAT Cytochrome c, somatic (Gene Name=Cycs)

[Back to BioLiP]