Structure of PDB 5d8l Chain B Binding Site BS02

Receptor Information
>5d8l Chain B (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKH
NNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLE
NIKRKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d8l Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors.
Resolution2.069 Å
Binding residue
(original residue number in PDB)		K54 R63 N66 R71 K72
Binding residue
(residue number reindexed from 1)		K49 R58 N61 R66 K67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5d8l, PDBe:5d8l, PDBj:5d8l
PDBsum5d8l
PubMed26727490
UniProtQ03933|HSF2_HUMAN Heat shock factor protein 2 (Gene Name=HSF2)

[Back to BioLiP]