Structure of PDB 5d4s Chain B Binding Site BS02

Receptor Information

>5d4s Chain B (length=83) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HHHLEVLFQGPLSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQ
QFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA

Ligand information

>5d4s Chain U (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaatacatacgtacaaatatt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5d4s Plasticity in Repressor-DNA Interactions Neutralizes Loss of Symmetry in Bipartite Operators.
Resolution	1.972 Å
Binding residue (original residue number in PDB)	P3 K4 Y5 S40 H42 T43 Q61 G62
Binding residue (residue number reindexed from 1)	P18 K19 Y20 S55 H57 T58 Q76 G77
Binding affinity	PDBbind-CN: Kd=277nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5d4s, PDBe:5d4s, PDBj:5d4s
PDBsum	5d4s
PubMed	26511320
UniProt	P96711\|ARAR_BACSU Arabinose metabolism transcriptional repressor (Gene Name=araR)

[Back to BioLiP]