Structure of PDB 5cqq Chain B Binding Site BS02

Receptor Information
>5cqq Chain B (length=75) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTPRFTAEEKEVLYTLFHLHEEVIDIKHRNKYSVRETWDKIVKDFNSHPH
VSAMRNIKQIQKFWLNSRLRKQYPY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5cqq Structure of Zeste-DNA Complex Reveals a New Modality of DNA Recognition by Homeodomain-Like Proteins
Resolution3.1 Å
Binding residue
(original residue number in PDB)
T53 F56 K117 N121 R125
Binding residue
(residue number reindexed from 1)
T2 F5 K62 N66 R70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5cqq, PDBe:5cqq, PDBj:5cqq
PDBsum5cqq
PubMed26478222
UniProtP09956|ZEST_DROME Regulatory protein zeste (Gene Name=z)

[Back to BioLiP]