Structure of PDB 5clv Chain B Binding Site BS02

Receptor Information
>5clv Chain B (length=96) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAV
SQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKKQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5clv Flexibility of KorA, a plasmid-encoded, global transcription regulator, in the presence and the absence of its operator.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		P36 Q37 A38 R48 S52
Binding residue
(residue number reindexed from 1)		P35 Q36 A37 R47 S51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding

View graph for
Molecular Function
External links
PDB RCSB:5clv, PDBe:5clv, PDBj:5clv
PDBsum5clv
PubMed27016739
UniProtP03052|KORA2_ECOLX TrfB transcriptional repressor protein (Gene Name=trfB)

[Back to BioLiP]