Structure of PDB 5cdw Chain B Binding Site BS02

Receptor Information
>5cdw Chain B (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGN
DVQHFKVLRDGAGKYFLGVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5cdw Structural and biophysical investigation of the interaction of a mutant Grb2 SH2 domain (W121G) with its cognate phosphopeptide.
Resolution2.602 Å
Binding residue
(original residue number in PDB)
A16 E19 S38
Binding residue
(residue number reindexed from 1)
A15 E18 S37
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5cdw, PDBe:5cdw, PDBj:5cdw
PDBsum5cdw
PubMed26645482
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]