Structure of PDB 5c8e Chain B Binding Site BS02

Receptor Information

>5c8e Chain B (length=276) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GVYTIAEVEAMTGLSAEVLRQWERRYGFPKPRRTPGGHRLYSAEDVEALK
TIKRWLEEGATPKAAIRRYLAQEVRPEDLGTGLLEALLRGDLAGAEALFR
RGLRFWGPEGVLEHLLLPVLREVGEAWHRGEIGVAEEHLASTFLRARLQE
LLDLAGFPPGPPVLVTTPPGERHEIGAMLAAYHLRRKGVPALYLGPDTPL
PDLRALARRLGAGAVVLSAVLSEPLRALPDGALKDLAPRVFLGGQGAGPE
EARRLGAEYMEDLKGLAEALWLPRGP

Ligand information

>5c8e Chain J (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atgtacaaaagcttgacaaaacctat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5c8e Structural basis for gene regulation by a B12-dependent photoreceptor.
Resolution	3.89 Å
Binding residue (original residue number in PDB)	Q25 G41 R43
Binding residue (residue number reindexed from 1)	Q21 G37 R39

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0031419	cobalamin binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5c8e, PDBe:5c8e, PDBj:5c8e
PDBsum	5c8e
PubMed	26416754
UniProt	Q746J7

[Back to BioLiP]