Structure of PDB 5c5e Chain B Binding Site BS02

Receptor Information
>5c5e Chain B (length=284) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSQIAICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQTHRDQ
IDCLILVAANPSFRAVVQQLCFEGVVVPAIVVGDRDSEDPDEPAKEQLYH
SAELHLGIHQLEQLPYQVDAALAEFLRLAPVETMADHIMLMGANHDPELS
SQQRDLAQRLQERLGYLGVYYKRDPDRFLRNLPAYESQKLHQAMQTSYRE
IVLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIHMELMDEFAKKLRV
EGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRET
Ligand information
>5c5e Chain H (length=20) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DEKSELSRIVRGVQEKGPES
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5c5e Protein-Protein Interactions in the Cyanobacterial Circadian Clock: Structure of KaiA Dimer in Complex with C-Terminal KaiC Peptides at 2.8 angstrom Resolution.
Resolution2.82 Å
Binding residue
(original residue number in PDB)
D217 L263 H271 R278
Binding residue
(residue number reindexed from 1)
D217 L263 H271 R278
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006468 protein phosphorylation
GO:0007623 circadian rhythm
GO:0009649 entrainment of circadian clock
GO:0042753 positive regulation of circadian rhythm
GO:0048511 rhythmic process
GO:0051776 detection of redox state

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5c5e, PDBe:5c5e, PDBj:5c5e
PDBsum5c5e
PubMed26200123
UniProtQ79PF6|KAIA_SYNE7 Circadian clock oscillator protein KaiA (Gene Name=kaiA)

[Back to BioLiP]