Structure of PDB 5bpd Chain B Binding Site BS02

Receptor Information

>5bpd Chain B (length=262) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SKDRMVELLQEHFELNLYEARAYVALVAFGVLTPAELASVSEVPAPRTYD
VLRSLEKKGFAMTQPGKTNKYRPVHPANVLEKFIQDWQERVKEELEAKKK
AKEELLELMAPLIETEVPKYGVERVWVVRGIKNSTLKTKEMLEEAQNEIL
LADDGFIAVNLEDDIIKAVDRGVKTKILLTKNLLPRLKASKIIDYAKEGK
LELRALDKFDLPMLICDEEVFFALEDLAARYFNYETQVWIKDHRVVALFK
EKFNEYWEKAEK

Ligand information

>5bpd Chain F (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tatatcactatcgatgatata

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5bpd Structural Insights into Nonspecific Binding of DNA by TrmBL2, an Archaeal Chromatin Protein.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	L18 Y19 P47 R48
Binding residue (residue number reindexed from 1)	L17 Y18 P46 R47

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:5bpd, PDBe:5bpd, PDBj:5bpd
PDBsum	5bpd
PubMed	26299937
UniProt	Q8U3H1\|TMBL2_PYRFU Putative HTH-type transcriptional regulator TrmBL2 (Gene Name=trmBL2)

[Back to BioLiP]