Structure of PDB 5bng Chain B Binding Site BS02

Receptor Information
>5bng Chain B (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARR
RIVQPMIDQS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bng DNA-dependent formation of transcription factor pairs alters their binding specificity.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		Q44 W48 R55
Binding residue
(residue number reindexed from 1)		Q40 W44 R51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5bng, PDBe:5bng, PDBj:5bng
PDBsum5bng
PubMed26550823
UniProtO14770|MEIS2_HUMAN Homeobox protein Meis2 (Gene Name=MEIS2)

[Back to BioLiP]