Structure of PDB 5aiy Chain B Binding Site BS02

Receptor Information
>5aiy Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>5aiy Chain I (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5aiy Unraveling the symmetry ambiguity in a hexamer: calculation of the R6 human insulin structure.
ResolutionN/A
Binding residue
(original residue number in PDB)
F1 V2 N3 H5 L6
Binding residue
(residue number reindexed from 1)
F1 V2 N3 H5 L6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:5aiy, PDBe:5aiy, PDBj:5aiy
PDBsum5aiy
PubMed10723989
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]