Structure of PDB 5a78 Chain B Binding Site BS02

Receptor Information
>5a78 Chain B (length=158) Species: 3077 (Chlorella vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFHDQLKFAWLAGFVDADGCINAQIVSREDYLLKYQVRVSLTVFQSTTQH
FILLDIQKILGCGTVRKRNDGMSEFCVVGGTSLQTTLEKLLPYLQLKRAQ
AKLVLQIIKKLPNTKDPSVLMEAALLADKVGLLTDGKKRTILAENVRECL
KKLGHVVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a78 Crystal Structure of the Homing Endonuclease I-Cvui Provides a New Template for Genome Modification
Resolution2.5 Å
Binding residue
(original residue number in PDB)		D23 C25 N27 Q29 R33 R43 F49 Q50 S51 R73 M77 G141 K143 R144 I146
Binding residue
(residue number reindexed from 1)		D18 C20 N22 Q24 R28 R38 F44 Q45 S46 R68 M72 G136 K138 R139 I141
Enzymatic activity
Catalytic site (original residue number in PDB) A22 D23
Catalytic site (residue number reindexed from 1) A17 D18
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a78, PDBe:5a78, PDBj:5a78
PDBsum5a78
PubMed26363068
UniProtP56347|DNE1_CHLVU DNA endonuclease I-CvuI

[Back to BioLiP]