Structure of PDB 5a0m Chain B Binding Site BS02

Receptor Information

>5a0m Chain B (length=227) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KNIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRD
EGKTYCMQFEWKNKAYMDHVCLLYDQWVLSPPHKKERVNHLGNLVITWGA
QTFKHQAFNKLANLFIVNNKKTIPNNLVENYLTPMSLAYWFMDDGGKWDY
NKNSTNTSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYID
SMSYLIFYNLIKPYLIPQMMYKLPNTI

Ligand information

>5a0m Chain H (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtattaccctgttat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5a0m Structure of the I-Scei Nuclease Complexed with its DsDNA Target and Three Catalytic Metal Ions.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	P314 N315 K320 K323 S381 H384 K386 R388 Q402 F404 K405 Q465 S466 K493 K495
Binding residue (residue number reindexed from 1)	P13 N14 K19 K22 S80 H83 K85 R87 Q101 F103 K104 Q164 S165 K192 K194

Enzymatic activity

Enzyme Commision number

3.1.-.-

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity

	Biological Process
GO:0006314	intron homing
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0005739	mitochondrion

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5a0m, PDBe:5a0m, PDBj:5a0m
PDBsum	5a0m
PubMed	27303901
UniProt	P03882\|SCE1_YEAST Intron-encoded endonuclease I-SceI (Gene Name=SCEI)

[Back to BioLiP]