Structure of PDB 4z8m Chain B Binding Site BS02

Receptor Information
>4z8m Chain B (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPT
AQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEI
MDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEV
STRFDLEH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z8m Structural Insights into Mitochondrial Antiviral Signaling Protein (MAVS)-Tumor Necrosis Factor Receptor-associated Factor 6 (TRAF6) Signaling
Resolution2.95 Å
Binding residue
(original residue number in PDB)		R392 F410 L457 P468 G470 F471 G472 Y473
Binding residue
(residue number reindexed from 1)		R43 F61 L108 P119 G121 F122 G123 Y124
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0016567 protein ubiquitination
GO:0043122 regulation of canonical NF-kappaB signal transduction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4z8m, PDBe:4z8m, PDBj:4z8m
PDBsum4z8m
PubMed26385923
UniProtQ9Y4K3|TRAF6_HUMAN TNF receptor-associated factor 6 (Gene Name=TRAF6)

[Back to BioLiP]