Structure of PDB 4yrv Chain B Binding Site BS02

Receptor Information
>4yrv Chain B (length=286) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMT
YLEQGQNLRMTGHLHHLEPKRVKIIVEEVRQALMEGKLLKTLGSQEPRYL
IQFPYVWMEQYPWIPGRSRIPGTSLTSEEKRQIEHKLPSNLPDAQLVTSF
EFLELIEFLHKRSQEDLPPEHRMELSEALAEHIKRRLLYSGTVTRIDSPW
GMPFYALTRPFYERTYIMVEDTARYFRMMKDWAEKRPNAMRALEELDVPP
ERWDEAMQELDEIIRTWADKYHQVPMILQMVFGRKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yrv Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
Resolution2.8 Å
Binding residue
(original residue number in PDB)		G36 N60 L61 R62 K73 K76 S179 E180 A181
Binding residue
(residue number reindexed from 1)		G33 N57 L58 R59 K70 K73 S176 E177 A178
Enzymatic activity
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0042802 identical protein binding
Biological Process
GO:0006508 proteolysis
GO:0043158 heterocyst development

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4yrv, PDBe:4yrv, PDBj:4yrv
PDBsum4yrv
PubMed26576507
UniProtP27709|HETR_NOSS1 DNA-binding transcriptional activator HetR (Gene Name=hetR)

[Back to BioLiP]