Structure of PDB 4ypr Chain B Binding Site BS02

Receptor Information

>4ypr Chain B (length=350) Species: 1422 (Geobacillus stearothermophilus)

ERFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVI
PYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTR
YGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLF
LVTDDIAKCSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSC
LLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRK
RDSTGLLANLWEFPSCETDGADGKEKLEQMVGQVELTEPIVSFEHAFSHL
VWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWAS

Ligand information

>4ypr Chain F (length=11)

aagacgtggac

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4ypr Structural Basis for Avoidance of Promutagenic DNA Repair by MutY Adenine DNA Glycosylase.
• Resolution: 2.59 Å
• Binding residue (original residue number in PDB): Q48 R50 T53 G85 G87 Y88 Y89 R201 G260 L261 L262 H305 A306 F307 S308 H309 V346
• Binding residue (residue number reindexed from 1): Q43 R45 T48 G80 G82 Y83 Y84 R196 G255 L256 L257 H295 A296 F297 S298 H299 V336

Enzymatic activity

• Catalytic site (original residue number in PDB): E43 Y126 N144
• Catalytic site (residue number reindexed from 1): E38 Y121 N139
• Enzyme Commision number: 3.2.2.31: adenine glycosylase.

Gene Ontology

Molecular Function

• GO:0000701 purine-specific mismatch base pair DNA N-glycosylase activity
• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0019104 DNA N-glycosylase activity
• GO:0032357 oxidized purine DNA binding
• GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
• GO:0035485 adenine/guanine mispair binding
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair
• GO:0006298 mismatch repair
• GO:0006950 response to stress

External links

• PDB: RCSB:4ypr, PDBe:4ypr, PDBj:4ypr
• PDBsum: 4ypr
• PubMed: 25995449
• UniProt: P83847|MUTY_GEOSE Adenine DNA glycosylase (Gene Name=mutY)