Structure of PDB 4wwc Chain B Binding Site BS02

Receptor Information

>4wwc Chain B (length=231) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HMNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRM
TVRQALSNLVNEGLLYRLKGRGTFVSKPKMEQGLTSFTEDMKSRGMTPGS
RLIDYQLIDSEELAAILGCGPSSIHKITRVRLANDIPMAIESSHIPFELA
GELNESIYDHIERYNSIPISRAKQELEPSAATTEEANILGIQKGAPVLLI
KRTTYLQNGTAFEHAKSVYRGDRYTFVHYMD

Ligand information

>4wwc Chain F (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cagtggtctagaccactgg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4wwc Structural insight into operator dre-sites recognition and effector binding in the GntR/HutC transcription regulator NagR.
Resolution	2.903 Å
Binding residue (original residue number in PDB)	P10 I11 Y12 I46 S47 M49 T50
Binding residue (residue number reindexed from 1)	P11 I12 Y13 I47 S48 M50 T51

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045892	negative regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4wwc, PDBe:4wwc, PDBj:4wwc
PDBsum	4wwc
PubMed	25564531
UniProt	O34817\|NAGR_BACSU HTH-type transcriptional repressor NagR (Gene Name=nagR)

[Back to BioLiP]