Structure of PDB 4wht Chain B Binding Site BS02

Receptor Information

>4wht Chain B (length=215) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIVLTQTTPTLSATIGQSVSISCRSSQSLLESDGNTYLNWLLQRPGQSPQ
LLIYSVSNLESGVPNRFSGSGSETDFTLKISGVEAEDLGVYYCMQTTHAP
TFGAGTKLELKRADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISV
KWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEV
VHKTSSSPVVKSFNR

Ligand information

>4wht Chain i (length=12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QLINTNGSWHVN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4wht Structural flexibility of a conserved antigenic region in hepatitis C virus glycoprotein e2 recognized by broadly neutralizing antibodies.
Resolution	2.22 Å
Binding residue (original residue number in PDB)	S18 V19 S20 S22 S70 K79
Binding residue (residue number reindexed from 1)	S18 V19 S20 S22 S70 K79

External links

PDB	RCSB:4wht, PDBe:4wht, PDBj:4wht
PDBsum	4wht
PubMed	25473061

[Back to BioLiP]