Structure of PDB 4uyj Chain B Binding Site BS02

Receptor Information
>4uyj Chain B (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPPADNKCLLRAT
DGKKKISTVVSSKEVNKFQMAYSNLLRANMDG
Ligand information
>4uyj Chain S (length=110) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggcuaggccgggggguucggcguccccuguaaccggaaaccgccgaua
ugccggggccgaagcccgaggggcgguucccguaaggguucccacccucg
ggcgugccuc
<<<<<..<<<<<<<<<<..(((((>>>>>>....<<<<....)))))...
..>>>>>>>>...<<<<<<<<<..<<..<<<....>>>..>>..>>>>>>
>>>..>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uyj Crystal Structure of a Signal Recognition Particle Alu Domain in the Elongation Arrest Conformation.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		E7 Q80
Binding residue
(residue number reindexed from 1)		E7 Q69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008312 7S RNA binding
GO:0030942 endoplasmic reticulum signal peptide binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4uyj, PDBe:4uyj, PDBj:4uyj
PDBsum4uyj
PubMed25336584
UniProtP37108|SRP14_HUMAN Signal recognition particle 14 kDa protein (Gene Name=SRP14)

[Back to BioLiP]