Structure of PDB 4u7b Chain B Binding Site BS02

Receptor Information
>4u7b Chain B (length=342) Species: 7226 (Drosophila mauritiana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRF
KSGDFDVDDKEHGKPPKRYEDAELQALLDEDDAQTQKQLAEQLEVSQQAV
SNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIV
TGDEKWIFFVNPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVI
YYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHRVIFLHANAPS
HTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSY
ESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4u7b Structural role of the flanking DNA in mariner transposon excision.
Resolution3.09 Å
Binding residue
(original residue number in PDB)		K115 V116 R118 P121 K158 K166 A275 Y276 P278 D284 Y285 F288 A289 G292 H293
Binding residue
(residue number reindexed from 1)		K112 V113 R115 P118 K155 K163 A272 Y273 P275 D281 Y282 F285 A286 G289 H290
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000014 single-stranded DNA endodeoxyribonuclease activity
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003697 single-stranded DNA binding
GO:0004519 endonuclease activity
GO:0042800 histone H3K4 methyltransferase activity
GO:0044547 DNA topoisomerase binding
GO:0046872 metal ion binding
GO:0046975 histone H3K36 methyltransferase activity
Biological Process
GO:0000729 DNA double-strand break processing
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006310 DNA recombination
GO:0006338 chromatin remodeling
GO:0015074 DNA integration
GO:0031297 replication fork processing
GO:0044774 mitotic DNA integrity checkpoint signaling
Cellular Component
GO:0000793 condensed chromosome
GO:0005634 nucleus
GO:0035861 site of double-strand break

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4u7b, PDBe:4u7b, PDBj:4u7b
PDBsum4u7b
PubMed25662605
UniProtQ7JQ07|MOS1T_DROMA Mariner Mos1 transposase (Gene Name=mariner\T)

[Back to BioLiP]