Structure of PDB 4tnt Chain B Binding Site BS02

Receptor Information
>4tnt Chain B (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRLQKCLQAGMNLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tnt Crystal structure of the mineralocorticoid receptor DNA binding domain in complex with DNA.
Resolution2.3938 Å
Binding residue
(original residue number in PDB)
C613 H614 Y615 K624 K628
Binding residue
(residue number reindexed from 1)
C14 H15 Y16 K25 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4tnt, PDBe:4tnt, PDBj:4tnt
PDBsum4tnt
PubMed25188500
UniProtP08235|MCR_HUMAN Mineralocorticoid receptor (Gene Name=NR3C2)

[Back to BioLiP]