Structure of PDB 4s0h Chain B Binding Site BS02

Receptor Information
>4s0h Chain B (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRY
KSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4s0h Intermolecular Interactions of Cardiac Transcription Factors NKX2.5 and TBX5.
Resolution2.817 Å
Binding residue
(original residue number in PDB)
Q187 R190 Y191 K194
Binding residue
(residue number reindexed from 1)
Q46 R49 Y50 K53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4s0h, PDBe:4s0h, PDBj:4s0h
PDBsum4s0h
PubMed26926761
UniProtP52952|NKX25_HUMAN Homeobox protein Nkx-2.5 (Gene Name=NKX2-5)

[Back to BioLiP]