Structure of PDB 4roe Chain B Binding Site BS02

Receptor Information
>4roe Chain B (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREP
RTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQN
MVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVS
GKVVLTGAKVRAEIYEAFENIYPILKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4roe Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Q166 N167 V169 R196 F197 R203 R208 T210 L212 T222 G223 V259 P289 F305 S307 K309 V311
Binding residue
(residue number reindexed from 1)		Q9 N10 V12 R39 F40 R46 R51 T53 L55 T65 G66 V102 P132 F148 S150 K152 V154
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4roe, PDBe:4roe, PDBj:4roe
PDBsum4roe
PubMed26638071
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]