Structure of PDB 4rd5 Chain B Binding Site BS02

Receptor Information
>4rd5 Chain B (length=159) Species: 242231 (Neisseria gonorrhoeae FA 1090) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGVQKIAPEQIRQLFAQTSEYHFSIPAKTEEKSNLNVFFGEGRRDKRGFV
KPRPWYEVELIVSKDITSQEGYPVLKSFTVITDDGWQFQCKTSGDYSKNF
RSENDLKTLGKWIKGRLESHGCLQNNEKITHETLREYGNDHFELRSTDNP
DVWLLSFKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rd5 Crystal structure of the R-protein of the multisubunit ATP-dependent restriction endonuclease NgoAVII.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K212 E214 K216 S217 G224 E225 R237 E243 I245 S247 K248 K282
Binding residue
(residue number reindexed from 1)		K28 E30 K32 S33 G40 E41 R53 E59 I61 S63 K64 K98
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
External links