Structure of PDB 4r8u Chain B Binding Site BS02

Receptor Information
>4r8u Chain B (length=338) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKF
GVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLS
LDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKI
ASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCG
DVQKCDLVMLLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAE
DIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQE
HVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r8u Fast native-SAD phasing for routine macromolecular structure determination
Resolution2.3 Å
Binding residue
(original residue number in PDB)
E105 K151 G184 G186 V188 S189 R286 T299 T300 Q301 E302 H303 V304
Binding residue
(residue number reindexed from 1)
E103 K149 G182 G184 V186 S187 R284 T297 T298 Q299 E300 H301 V302
Enzymatic activity
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0005515 protein binding
GO:0008296 3'-5'-DNA exonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0000731 DNA synthesis involved in DNA repair
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006281 DNA repair
GO:0006974 DNA damage response
GO:0009432 SOS response
GO:0042276 error-prone translesion synthesis
GO:0070987 error-free translesion synthesis
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4r8u, PDBe:4r8u, PDBj:4r8u
PDBsum4r8u
PubMed25506719
UniProtQ47155|DPO4_ECOLI DNA polymerase IV (Gene Name=dinB)

[Back to BioLiP]