Structure of PDB 4r4e Chain B Binding Site BS02

Receptor Information

>4r4e Chain B (length=84) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARTEGNRRLFS
FHDVDKLLEIKHLIEQGVNMAGIKQILAKAEAEP

Ligand information

>4r4e Chain E (length=8) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgtcagta

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4r4e Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis.
Resolution	2.57 Å
Binding residue (original residue number in PDB)	S24 R26 Q27 Y30 R46
Binding residue (residue number reindexed from 1)	S24 R26 Q27 Y30 R46
Binding affinity	PDBbind-CN: Kd=8.1nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4r4e, PDBe:4r4e, PDBj:4r4e
PDBsum	4r4e
PubMed	25691471
UniProt	P37582\|GLNR_BACSU HTH-type transcriptional regulator GlnR (Gene Name=glnR)

[Back to BioLiP]