Structure of PDB 4qtk Chain B Binding Site BS02

Receptor Information
>4qtk Chain B (length=148) Species: 237561 (Candida albicans SC5314) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVPTYNGYIHNTRDALAVIQQVLDKQLEPVSRRPHERERGVLIVSGSVFV
FIEQSSGIKRWTDGISWSPSRIQGRFLVYGELNGLVKKTITLTTTTKELH
MEGKAEKQTIHLISYYSKQDIDSGKLQRPSESDLKHVQISPALWTMVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qtk Crystal structure of the WOPR-DNA complex and implications for Wor1 function in white-opaque switching of Candida albicans.
Resolution2.99 Å
Binding residue
(original residue number in PDB)
R65 W66 L82 Y84 K206 T210
Binding residue
(residue number reindexed from 1)
R60 W61 L77 Y79 K87 T91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4qtk, PDBe:4qtk, PDBj:4qtk
PDBsum4qtk
PubMed25091450
UniProtQ5AP80|WOR1_CANAL White-opaque regulator 1 (Gene Name=WOR1)

[Back to BioLiP]