Structure of PDB 4qju Chain B Binding Site BS02

Receptor Information

>4qju Chain B (length=90) Species: 158878 (Staphylococcus aureus subsp. aureus Mu50) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNF
EVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK

Ligand information

>4qju Chain D (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgcttatcaatttgttgcacc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4qju beta-Arm flexibility of HU from Staphylococcus aureus dictates the DNA-binding and recognition mechanism
Resolution	2.16 Å
Binding residue (original residue number in PDB)	Q43 G46 N49 R55 R58 G60 R61 P63 Q64 I69 I71 G82
Binding residue (residue number reindexed from 1)	Q43 G46 N49 R55 R58 G60 R61 P63 Q64 I69 I71 G82
Binding affinity	PDBbind-CN: Kd=370nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0030527	structural constituent of chromatin

	Biological Process
GO:0030261	chromosome condensation

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4qju, PDBe:4qju, PDBj:4qju
PDBsum	4qju
PubMed	25478845
UniProt	Q99U17\|DBH_STAAM DNA-binding protein HU (Gene Name=hup)

[Back to BioLiP]