Structure of PDB 4q10 Chain B Binding Site BS02

Receptor Information
>4q10 Chain B (length=295) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVHSFWDIAGPTARPVRLESLEDKRMAVDASIWIYQFLKAVRDAVKNSHI
TGFFRRICKLLYFGIRPVFVFDGGVPVLKRETIRDEVTMDMIKEVQELLS
RFGIPYITAPMEAEAQCAELLQLNLVDGIITDDSDVFLFGGTKIYKNMFH
EKNYVEFYDAESILKLLGLDRKNMIELAQLLGSDYTNGLKGMGPVSSIEV
IAEFGNLKNFKDWYNNGQFNKFEKDLRKKLVNNEIILDDDFPSVMVYDAY
MRPEVDHDTTPFVWGVPDLDMLRSFMKTQLGWPHEKSDEILIPLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4q10 Crystal structure of the catalytic core of Rad2: insights into the mechanism of substrate binding.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
K40 A41 K870 G871 G873 P874 V875 S876
Binding residue
(residue number reindexed from 1)
K39 A40 K190 G191 G193 P194 V195 S196
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0003824 catalytic activity
GO:0004518 nuclease activity
GO:0004519 endonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
Biological Process
GO:0006289 nucleotide-excision repair
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4q10, PDBe:4q10, PDBj:4q10
PDBsum4q10
PubMed25120270
UniProtP07276|RAD2_YEAST DNA repair protein RAD2 (Gene Name=RAD2)

[Back to BioLiP]