Structure of PDB 4omy Chain B Binding Site BS02

Receptor Information
>4omy Chain B (length=97) Species: 380 (Sinorhizobium fredii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLS
QSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4omy Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
Resolution3.062 Å
Binding residue
(original residue number in PDB)		A44 V45 G46 Q56 S57 S60 T80 I81 Y83
Binding residue
(residue number reindexed from 1)		A39 V40 G41 Q51 S52 S55 T75 I76 Y78
Binding affinityPDBbind-CN: Kd=0.43uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4omy, PDBe:4omy, PDBj:4omy
PDBsum4omy
PubMed24733893
UniProtQ83TD2

[Back to BioLiP]