Structure of PDB 4nmt Chain B Binding Site BS02

Receptor Information
>4nmt Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVG
DAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nmt Chemically Modified Peptide Scaffolds Target the CFTR-Associated Ligand PDZ Domain.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		G298 L299 G300 I301 S302 I303 T304 H309 V311 E317 H349 V353
Binding residue
(residue number reindexed from 1)		G15 L16 G17 I18 S19 I20 T21 H26 V28 E34 H66 V70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005794 Golgi apparatus

View graph for
Cellular Component
External links
PDB RCSB:4nmt, PDBe:4nmt, PDBj:4nmt
PDBsum4nmt
PubMed25136860
UniProtQ9HD26|GOPC_HUMAN Golgi-associated PDZ and coiled-coil motif-containing protein (Gene Name=GOPC)

[Back to BioLiP]