Structure of PDB 4nhj Chain B Binding Site BS02

Receptor Information
>4nhj Chain B (length=101) Species: 573 (Klebsiella pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HKTISFGSLTIDPVNRQVMLGGENVALSTADFDMLWELATHAGQIMDRDA
LLKNLRGVTYDGMDRSVDVAISRLRKKLLDNATEPYRIKTVRNKGYLFAP
H
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nhj Structural dynamics of the two-component response regulator RstA in recognition of promoter DNA element.
Resolution2.701 Å
Binding residue
(original residue number in PDB)		R182 R199 S206 A216 T224 R226 N227 Y230
Binding residue
(residue number reindexed from 1)		R48 R65 S72 A82 T90 R92 N93 Y96
Binding affinityPDBbind-CN: Kd=5.15uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4nhj, PDBe:4nhj, PDBj:4nhj
PDBsum4nhj
PubMed24990372
UniProtA6T8N1

[Back to BioLiP]