Structure of PDB 4lg0 Chain B Binding Site BS02

Receptor Information
>4lg0 Chain B (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKP
KMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAM
LDVKPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lg0 Structure of a ternary FOXO1-ETS1 DNA complex
Resolution2.19 Å
Binding residue
(original residue number in PDB)		Y386 R391 R394 Y395 Y397 K404 R409 Y410
Binding residue
(residue number reindexed from 1)		Y54 R59 R62 Y63 Y65 K72 R77 Y78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4lg0, PDBe:4lg0, PDBj:4lg0
PDBsum4lg0
PubMed
UniProtP14921|ETS1_HUMAN Protein C-ets-1 (Gene Name=ETS1)

[Back to BioLiP]