Structure of PDB 4l0y Chain B Binding Site BS02

Receptor Information
>4l0y Chain B (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPK
MNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAML
DVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l0y Structural basis of Ets1 activation by Runx1.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y386 R391 R394 Y397 K404 R409 Y410
Binding residue
(residue number reindexed from 1)		Y53 R58 R61 Y64 K71 R76 Y77
Binding affinityPDBbind-CN: Kd=3.1nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4l0y, PDBe:4l0y, PDBj:4l0y
PDBsum4l0y
PubMed24646888
UniProtP14921|ETS1_HUMAN Protein C-ets-1 (Gene Name=ETS1)

[Back to BioLiP]