Structure of PDB 4kfz Chain B Binding Site BS02

Receptor Information

>4kfz Chain B (length=148) Species: 9606 (Homo sapiens)

SLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCD
LCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTM
RVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKING

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 4kfz Chain B Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4kfz Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): C57 C60 C80 D83
• Binding residue (residue number reindexed from 1): C49 C52 C72 D75
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0001221 transcription coregulator binding
• GO:0003713 transcription coactivator activity
• GO:0005515 protein binding
• GO:0043425 bHLH transcription factor binding
• GO:0046872 metal ion binding
• GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
• GO:0140297 DNA-binding transcription factor binding

Biological Process

• GO:0045944 positive regulation of transcription by RNA polymerase II

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005667 transcription regulator complex

External links

• PDB: RCSB:4kfz, PDBe:4kfz, PDBj:4kfz
• PDBsum: 4kfz
• PubMed: 24407558
• UniProt: P25791|RBTN2_HUMAN Rhombotin-2 (Gene Name=LMO2)