Structure of PDB 4kfc Chain B Binding Site BS02

Receptor Information
>4kfc Chain B (length=224) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMANVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLI
ILDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYL
SKPFGIGELQARLRVALRRHSTAPDPLVKFSDVTVDLAARVIHRGEEEVH
LTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQ
KLEQDPARPRHFITATGIGYRFML
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4kfc An asymmetric heterodomain interface stabilizes a response regulator-DNA complex.
Resolution2.53 Å
Binding residue
(original residue number in PDB)		R193 T217 G218
Binding residue
(residue number reindexed from 1)		R192 T216 G217
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0000976 transcription cis-regulatory region binding
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4kfc, PDBe:4kfc, PDBj:4kfc
PDBsum4kfc
PubMed24526190
UniProtP21866|KDPE_ECOLI KDP operon transcriptional regulatory protein KdpE (Gene Name=kdpE)

[Back to BioLiP]