Structure of PDB 4jjn Chain B Binding Site BS02

Receptor Information
>4jjn Chain B (length=89) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLE
SVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Ligand information
>4jjn Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jjn Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
Resolution3.09 Å
Binding residue
(original residue number in PDB)		R19 T30 P32 R36 R45
Binding residue
(residue number reindexed from 1)		R6 T17 P19 R23 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0042802 identical protein binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006355 regulation of DNA-templated transcription
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0045943 positive regulation of transcription by RNA polymerase I
Cellular Component
GO:0000500 RNA polymerase I upstream activating factor complex
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jjn, PDBe:4jjn, PDBj:4jjn
PDBsum4jjn
PubMed23650358
UniProtP02309|H4_YEAST Histone H4 (Gene Name=HHF1)

[Back to BioLiP]